Rabbit Polyclonal Anti-PISD Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PISD antibody is: synthetic peptide directed towards the C-terminal region of Human PISD. Synthetic peptide located within the following region: WKHGFFSLTAVGATNVGSIRIYFDRDLHTNSPRHSKGSYNDFSFVTHTNR |
Rabbit Polyclonal Anti-PISD Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PISD antibody is: synthetic peptide directed towards the C-terminal region of Human PISD. Synthetic peptide located within the following region: MCTEDLPFPPAASCDSFKNQLVTREGNELYHCVIYLAPGDYHCFHSPTDW |
Germany
Japan
United Kingdom
China