Antibodies

Jump to Filters
View as table Download
DUSP8 Rabbit Polyclonal Antibody
TA322744

USD 380.00

In Stock

Anti-DUSP8 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 2-14 amino acids of Human dual specificity phosphatase 8
DUSP8 Rabbit Polyclonal Antibody
TA322743

USD 380.00

In Stock

Anti-DUSP8 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 2-14 amino acids of Human dual specificity phosphatase 8
DUSP8 Goat Polyclonal Antibody
TA302764

USD 520.00

5 Days

Goat Polyclonal Antibody against DUSP8

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence *AGDRLPRKVMDAK-C, from the N Terminus of the protein sequence according to NP_004411.1.
DUSP8 Rabbit Polyclonal Antibody
TA340054

USD 539.00

5 Days

Rabbit Polyclonal Anti-DUSP8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DUSP8 antibody: synthetic peptide directed towards the middle region of human DUSP8. Synthetic peptide located within the following region: PAPPTPPATSALQQGLRGLHLSSDRLQDTNRLKRSFSLDIKSAYAPSRRP