Rabbit polyclonal antibody to Interleukin-24 (interleukin 24)
| Applications | WB |
| Reactivities | Human (Predicted: Mouse, Rat) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 142 and 206 of IL24 (Uniprot ID#Q13007) |
Rabbit Polyclonal Anti-IL24 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IL24 antibody is: synthetic peptide directed towards the C-terminal region of IL24. Synthetic peptide located within the following region: STLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALT |
Germany
Japan
United Kingdom
China