Antibodies

Jump to Filters
View as table Download
SDS (N-term) Rabbit Polyclonal Antibody
AP53827PU-N

USD 580.00

2 Weeks

SDS (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 1~30 amino acids from the N-terminal region of Human SDS.
SDS Rabbit Polyclonal Antibody
TA346121

USD 539.00

5 Days

Rabbit Polyclonal Anti-SDS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SDS antibody: synthetic peptide directed towards the N terminal of human SDS. Synthetic peptide located within the following region: AAAYAARQLGVPATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELA
SDS Rabbit Polyclonal Antibody
TA346122

USD 539.00

5 Days

Rabbit Polyclonal Anti-SDS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SDS antibody: synthetic peptide directed towards the middle region of human SDS. Synthetic peptide located within the following region: KITSVAKALGVKTVGAQALKLFQEHPIFSEVISDQEAVAAIEKFVDDEKI