Antibodies

Jump to Filters
View as table Download
NEGR1 Rabbit Polyclonal Antibody
TA316275

USD 380.00

4 Weeks

Rabbit polyclonal anti-NEGR1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NEGR1.
NEGR1 Rabbit Polyclonal Antibody
TA331416

USD 539.00

5 Days

Rabbit polyclonal Anti-NEGR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NEGR1 antibody: synthetic peptide directed towards the N terminal of human NEGR1. Synthetic peptide located within the following region: WLNRSSIIFAGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDGPYTCSV