Antibodies

View as table Download

GFPT2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 181~210 amino acids from the Center region of human GFPT2 / GFAT2

Rabbit Polyclonal Anti-GFPT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GFPT2 antibody: synthetic peptide directed towards the N terminal of human GFPT2. Synthetic peptide located within the following region: DLRKFLESKGYEFESETDTETIAKLIKYVFDNRETEDITFSTLVERVIQQ

Rabbit Polyclonal Anti-GFPT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GFPT2 antibody: synthetic peptide directed towards the middle region of human GFPT2. Synthetic peptide located within the following region: TARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFH