Rabbit Polyclonal ABCA7 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | ABCA7 antibody was raised against an 18 amino acid synthetic peptide near the amino terminus of human ABCA7. |
Rabbit Polyclonal ABCA7 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | ABCA7 antibody was raised against an 18 amino acid synthetic peptide near the amino terminus of human ABCA7. |
Rabbit Polyclonal Anti-Abca7 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Abca7 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DTQTRHLSGGMQRKLSVAIAFVGGSRVVIMDEPTAGVDPASRRGIWELLL |