Antibodies

View as table Download

Rabbit Polyclonal Anti-PPP2CA Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PPP2CA

Rabbit Polyclonal Anti-PRKG2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PRKG2

Rabbit Polyclonal Anti-PLCB3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PLCB3

Calcium independent Phospholipase A2 (PLA2G6) (Center) rabbit polyclonal antibody, Purified

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated - corresponding to the central region (between 558-588aa) of human PLA2G6.

Rabbit polyclonal MEK2 (MAP2K2) Antibody (Center)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This MEK2 (MAP2K2) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 262-292 amino acids from the Central region of human MEK2 (MAP2K2).

Rabbit Polyclonal anti-GNAS antibody

Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GNAS antibody: synthetic peptide directed towards the N terminal of human GNAS. Synthetic peptide located within the following region: VYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSD

Rabbit Polyclonal Antibody against BRAF (Center)

Applications FC, IF, IHC, WB
Reactivities Human (Predicted: Mouse, Chicken)
Conjugation Unconjugated
Immunogen This B-RAF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 424-453 amino acids from the Central region of human B-RAF.

Rabbit Polyclonal antibody to GNAS (GNAS complex locus)

Applications IHC, WB
Reactivities Human, Mouse (Predicted: Dog, Pig, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 807 and 1037 of GNAS (Uniprot ID#Q5JWF2)

PKC alpha (PRKCA) (pan) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 470-520 of Human PKC-pan.

Anti-GRIA3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 290-302 amino acids of Human glutamate receptor, ionotropic, AMPA 3

Anti-GNAS Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 200 amino acids of human GNAS complex locus

Rabbit polyclonal NRAS Antibody (N-term)

Applications FC, IF, WB
Reactivities Human (Predicted: Mouse, Rat, Chicken, Pig)
Conjugation Unconjugated
Immunogen This NRAS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-101 amino acids from the N-terminal region of human NRAS.

Rabbit Polyclonal Anti-CRHR1 Antibody (Extracellular Domain)

Applications IHC
Reactivities Human (Predicted: Bat)
Conjugation Unconjugated
Immunogen CRFR1 / CRHR1 antibody was raised against synthetic 18 amino acid peptide from 1st extracellular domain of human CRF1. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Sheep, Hamster, Dog, Bovine, Horse, Pig, Opossum (100%); Elephant, Panda, Bat (94%); Marmoset, Mouse, Rat, Seabass, Stickleback, Pufferfish (89%); Turkey, Chicken, Lizard, Zebrafish (83%).

Rabbit polyclonal antibody to H-Ras (v-Ha-ras Harvey rat sarcoma viral oncogene homolog)

Applications IF, IHC, WB
Reactivities Human (Predicted: Xenopus, Chicken, Bovine, Rhesus Monkey, X. tropicalis)
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 111 and 189 of H-Ras (Uniprot ID#P01112)

Rabbit Polyclonal antibody to ARAF (v-raf murine sarcoma 3611 viral oncogene homolog)

Applications IF, IHC, WB
Reactivities Human, Mouse (Predicted: Pig, Rat, Zebrafish, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 371 and 554 of A-RAF (Uniprot ID#P10398)