Rabbit Polyclonal Anti-CSNK1D Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CSNK1D antibody: synthetic peptide directed towards the middle region of human CSNK1D. Synthetic peptide located within the following region: NLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSR |
Rabbit Polyclonal Anti-CRY2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CRY2 antibody: synthetic peptide directed towards the N terminal of human CRY2. Synthetic peptide located within the following region: IELNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDE |
Rabbit polyclonal antibody to SHARP2 (basic helix-loop-helix domain containing, class B, 2)
| Applications | IF, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 81 of SHARP2 (Uniprot ID#O14503) |
Rabbit Polyclonal Anti-ARNTL Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARNTL antibody: synthetic peptide directed towards the N terminal of human ARNTL. Synthetic peptide located within the following region: TDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSF |
Goat Polyclonal Antibody against Casein Kinase 1, delta
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DREERLRHSRNPATR, from the internal region of the protein sequence according to NP_001884.2; NP_620693.1. |
Rabbit Polyclonal Anti-ARNTL Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ARNTL |
PER3 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
BMAL1 (ARNTL) (569-573) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa.569~573 derived from Human BMAL1 |
PER1 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 1155-1183 amino acids from the C-terminal region of human PER1 |
Rabbit Polyclonal Anti-CLOCK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLOCK antibody: synthetic peptide directed towards the N terminal of human CLOCK. Synthetic peptide located within the following region: LFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFN |
BMAL1 (ARNTL) (569-573) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa.569~573 derived from Human BMAL1 |
SHARP2 (BHLHE40) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 29-59 amino acids from the N-terminal region of human BHLHE40 |
Goat Polyclonal Antibody against CSNK1E
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PASQTSVPFDHLGK, from the C Terminus of the protein sequence according to NP_001885.1; NP_689407.1. |
Goat Anti-BMAL1 / ARNTL Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence REKITTNCYKFKIKD, from the internal region of the protein sequence according to NP_001169.3; NP_001025444.1. |
Germany
Japan
United Kingdom
China
