Antibodies

Jump to Filters
View as table Download
POLR3G Rabbit Polyclonal Antibody
TA385005

USD 380.00

4 Weeks

RNA Polymerase III Subunit C7 Rabbit polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from the Internal region of human POLR3G. AA range:151-200
POLR3G Rabbit Polyclonal Antibody
TA332037

USD 539.00

5 Days

Rabbit Polyclonal Anti-POLR3G Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-POLR3G Antibody is: synthetic peptide directed towards the middle region of Human POLR3G. Synthetic peptide located within the following region: SKRYMKVYKEEWIPDWRRLPREMMPRNKCKKAGPKPKKAKDAGKGTPLTN