Antibodies

Jump to Filters
View as table Download
FOXC1 Goat Polyclonal Antibody
TA302875

USD 520.00

2 Weeks

Goat Polyclonal Antibody against FOXC1

Applications FC, WB
Reactivities Human, Mouse, Zebrafish
Conjugation Unconjugated
Immunogen Peptide with sequence RTSGAFVYDCSKF, from the C Terminus of the protein sequence according to NP_001444.1.
FOXC1 Rabbit Polyclonal Antibody
TA335192

USD 539.00

5 Days

Rabbit Polyclonal Anti-FOXC1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXC1 antibody: synthetic peptide directed towards the N terminal of human FOXC1. Synthetic peptide located within the following region: GGYTAMPAPMSVYSHPAHAEQYPGGMARAYGPYTPQPQPKDMVKPPYSYI
FOXC1 Rabbit Polyclonal Antibody
TA350668

USD 380.00

In Stock

Rabbit Polyclonal Anti-FOXC1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human FOXC1
FOXC1 Rabbit Polyclonal Antibody
TA311885

USD 380.00

4 Weeks

Rabbit polyclonal anti-FOXC1/2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FOXC1/2.
Modifications Phospho-specific
FOXC1 Rabbit Polyclonal Antibody
TA330238

USD 485.00

5 Days

Rabbit Polyclonal Anti-FOXC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXC1 antibody: synthetic peptide directed towards the C terminal of human FOXC1. Synthetic peptide located within the following region: GERGGHLQGAPGGAGGSAVDNPLPDYSLPPVTSSSSSSLSHGGGGGGGGG
FOXC1 Rabbit Polyclonal Antibody
TA335193

USD 539.00

5 Days

Rabbit Polyclonal Anti-FOXC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXC1 antibody: synthetic peptide directed towards the C terminal of human FOXC1. Synthetic peptide located within the following region: QQNFHSVREMFESQRIGLNNSPVNGNSSCQMAFPSSQSLYRTSGAFVYDC
FOXC1 Rabbit Polyclonal Antibody
TA341795

USD 539.00

5 Days

Rabbit Polyclonal Anti-Foxc1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Foxc1 antibody: synthetic peptide directed towards the n terminal of mouse Foxc1. Synthetic peptide located within the following region: MQARYSVSSPNSLGVVPYLGGEQSYYRAAAAAAGGGYTAMPAPMSVYSHP
FOXC1 Rabbit Polyclonal Antibody
TA376325

USD 365.00

3 Weeks

FOXC1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 404-553 of human FOXC1 (NP_001444.2).
Modifications Unmodified