Antibodies

Jump to Filters
View as table Download
NPPC Rabbit Polyclonal Antibody
TA322184

USD 380.00

2 Weeks

Anti-NPPC Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 111-125 amino acids of Human notch 4
NPPC Rabbit Polyclonal Antibody
TA344667

USD 539.00

5 Days

Rabbit Polyclonal Anti-NPPC Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Nppc antibody is: synthetic peptide directed towards the C-terminal region of Nppc. Synthetic peptide located within the following region: LLRDLRVDTKSRAAWARLLHEHPNARKYKGGNKKGLSKGCFGLKLDRIGS
NPPC Rabbit Polyclonal Antibody
TA364029

USD 1,005.00

2 Weeks

Rabbit polyclonal anti human / porcine / rat C-Type Natriuretic Peptide (CNP) (32-53)

Applications ELISA
Reactivities Human, Porcine, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide H-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu- Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys-OH (disulfide bond) coupled to carrier protein.