Antibodies

Jump to Filters
View as table Download
AIM2 Rabbit Polyclonal Antibody
TA349676

USD 380.00

In Stock

Rabbit Polyclonal Anti-AIM2 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human AIM2
AIM2 Rabbit Polyclonal Antibody
TA314913

USD 380.00

4 Weeks

Rabbit polyclonal anti-AIM2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human AIM2.
AIM2 Rabbit Polyclonal Antibody
TA314914

USD 380.00

In Stock

Rabbit polyclonal anti-CSRL1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CSRL1.
AIM2 Rabbit Polyclonal Antibody
TA373380

USD 365.00

3 Weeks

AIM2 Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human AIM2 (NP_004824.1).
Modifications Unmodified
AIM2 Rabbit Polyclonal Antibody
TA339684

USD 539.00

5 Days

Rabbit Polyclonal Anti-AIM2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AIM2 antibody: synthetic peptide directed towards the N terminal of human AIM2. Synthetic peptide located within the following region: ESKYKEILLLTGLDNITDEELDRFKFFLSDEFNIATGKLHTANRIQVATL
Aim2 Rabbit Polyclonal Antibody
TA389693

USD 365.00

3 Weeks

Aim2 Rabbit pAb

Applications WB
Reactivities Rat
Conjugation Unconjugated
AIM2 Rabbit Polyclonal Antibody
TA392793

USD 325.00

3 Weeks

AIM2 (A78) polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 51-100 of Human AIM2.