Goat Polyclonal Antibody against PTBP1
| Applications | IHC, WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence DGIVPDIAVGTKR-C, from the N Terminus of the protein sequence according to NP_002810.1; NP_114367.1; NP_114368.1; NP_787041.1. |
Rabbit Polyclonal Anti-PTBP1 Antibody
| Applications | WB |
| Reactivities | Human, Rat, Dog, Zebrafish, Bovine, Pig, Rabbit, Mouse, Guinea Pig, Horse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTBP1 antibody: synthetic peptide directed towards the middle region of human PTBP1. Synthetic peptide located within the following region: KGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI |
Germany
Japan
United Kingdom
China
