Antibodies

Jump to Filters
View as table Download
HTR2B Rabbit Polyclonal Antibody
TA321221

USD 380.00

4 Weeks

Anti-HTR2B Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 1-58 amino acids of human 5-hydroxytryptamine receptor 2B
HTR2B Rabbit Polyclonal Antibody
TA329175

USD 539.00

5 Days

Rabbit Polyclonal anti-HTR2B antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HTR2B antibody: synthetic peptide directed towards the N terminal of human HTR2B. Synthetic peptide located within the following region: QTESIPEEMKQIVEEQGNKLHWAALLILMVIIPTIGGNTLVILAVSLEKK
HTR2B Rabbit Polyclonal Antibody
TA321222

USD 380.00

4 Weeks

Anti-HTR2B Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 1-58 amino acids of Human 5-hydroxytryptamine receptor 2B
HTR2B Rabbit Polyclonal Antibody
TA314042

USD 380.00

4 Weeks

Rabbit polyclonal anti-5-HT-2B antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human 5-HT-2B.
HTR2B Rabbit Polyclonal Antibody
TA332831

USD 365.00

3 Weeks

Rabbit anti-HTR2B Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HTR2B