Antibodies

View as table Download

H4C1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human H4C1

H4C1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human H4C1

H4C1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human H4C1

Histone H4 Rabbit polyclonal Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat, Monkey
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Histone H4. AA range:6-55

Acetyl-Histone H4 (Lys16) Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic Peptide of Histone H4 (Acetyl Lys16) (Acetylated)

Phospho-Histone H4 (Ser1) Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding S1 of human Histone H4.Email for sequence (Phosphorylated)

Rabbit Polyclonal Anti-HIST1H4A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HIST1H4A antibody is: synthetic peptide directed towards the N-terminal region of Human HIST1H4A. Synthetic peptide located within the following region: LGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK