Antibodies

Jump to Filters
View as table Download
NCE2 (UBE2F) Rabbit Polyclonal Antibody
TA340244

USD 539.00

5 Days

Rabbit Polyclonal Anti-UBE2F Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-UBE2F antibody: synthetic peptide directed towards the N terminal of human UBE2F. Synthetic peptide located within the following region: MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVKEVAELEANLPC
NCE2 (UBE2F) Rabbit Polyclonal Antibody
TA340245

USD 539.00

5 Days

Rabbit Polyclonal Anti-UBE2F Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UBE2F antibody: synthetic peptide directed towards the middle region of human UBE2F. Synthetic peptide located within the following region: TLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDYIKRYA