Antibodies

Jump to Filters
View as table Download
H6PD Rabbit Polyclonal Antibody
TA339891

USD 539.00

5 Days

Rabbit Polyclonal Anti-H6PD Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H6PD antibody: synthetic peptide directed towards the N terminal of human H6PD. Synthetic peptide located within the following region: HFSAQQLATELGTFFQEEEMYRVDHYLGKQAVAQILPFRDQNRKALDGLW