Antibodies

View as table Download

Rabbit polyclonal anti-OR2T1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR2T1.

Rabbit Polyclonal Anti-OR2T1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OR2T1 antibody: synthetic peptide directed towards the C terminal of human OR2T1. Synthetic peptide located within the following region: KPAQDKVLSVFYTILTPMLNPLIYSLRNKDVTGALKRALGRFKGPQRVSG