Antibodies

Jump to Filters
View as table Download
Growth hormone receptor (GHR) Rabbit Polyclonal Antibody
TA323722

USD 380.00

2 Weeks

Anti-GHR Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 48-63 amino acids of Human growth hormone receptor
Growth hormone receptor (GHR) Rabbit Polyclonal Antibody
TA334654

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-GHR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GHR antibody: synthetic peptide directed towards the N terminal of human GHR. Synthetic peptide located within the following region: LQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLF
Growth hormone receptor (GHR) Rabbit Polyclonal Antibody
TA590807

USD 482.00

In Stock

Rabbit Polyclonal Growth hormone receptor Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.
Growth hormone receptor (GHR) Rabbit Polyclonal Antibody
TA334655

USD 539.00

5 Days

Rabbit Polyclonal Anti-GHR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GHR antibody is: synthetic peptide directed towards the C-terminal region of Human GHR. Synthetic peptide located within the following region: YSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQFTCEEDFYFPW