Antibodies

Jump to Filters
View as table Download
TRIP6 Rabbit Polyclonal Antibody
TA319726

USD 570.00

2 Weeks

Rabbit Polyclonal TRIP6 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen TRIP6 antibody was raised against a 15 amino acid synthetic peptide near the center of human TRIP6.
TRIP6 Rabbit Polyclonal Antibody
TA350544

USD 380.00

In Stock

Rabbit Polyclonal Anti-TRIP6 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human TRIP6
TRIP6 Rabbit Polyclonal Antibody
TA339222

USD 539.00

5 Days

Rabbit Polyclonal Anti-TRIP6

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRIP6 antibody: synthetic peptide directed towards the N terminal of human TRIP6. Synthetic peptide located within the following region: MSGPTWLPPKQPEPARAPQGRAIPRGTPGPPPAHGAALQPHPRVNFCPLP
TRIP6 Rabbit Polyclonal Antibody
TA339223

USD 539.00

5 Days

Rabbit Polyclonal Anti-TRIP6

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRIP6 antibody: synthetic peptide directed towards the middle region of human TRIP6. Synthetic peptide located within the following region: ASTPAGPAFPVQVKVAQPVRGCGPPRRGASQASGPLPGPHFPLPGRGEVW