Goat Polyclonal Antibody against MTR
| Applications | IHC, WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-VEKWLGPILGYDTD, from the C Terminus of the protein sequence according to NP_000245. |
Rabbit Polyclonal Anti-MTR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MTR antibody: synthetic peptide directed towards the C terminal of human MTR. Synthetic peptide located within the following region: GSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLADIEQSTGIRL |
Germany
Japan
United Kingdom
China
