Rabbit Polyclonal Anti-ZBTB16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZBTB16 antibody: synthetic peptide directed towards the C terminal of human ZBTB16. Synthetic peptide located within the following region: GASPYQCTICTEYCPSLSSMQKHMKGHKPEEIPPDWRIEKTYLYLCYV |
Rabbit anti-ZBTB16 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ZBTB16 |
Rabbit Polyclonal Anti-ZBTB16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ZBTB16 |
Germany
Japan
United Kingdom
China
