Antibodies

Jump to Filters
View as table Download
RNF5 Rabbit Polyclonal Antibody
TA351597

USD 380.00

In Stock

Rabbit Polyclonal Anti-RNF5 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human RNF5
RNF5 (Center) Rabbit Polyclonal Antibody
AP53694PU-N

USD 580.00

2 Weeks

RNF5 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 64-94 amino acids from the Central region of human RNF5
RNF5 (N-term) Rabbit Polyclonal Antibody
AP18182PU-N

USD 580.00

2 Weeks

RNF5 (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human RNF5
RNF5 Rabbit Polyclonal Antibody
TA344426

USD 539.00

5 Days

Rabbit Polyclonal Anti-RNF5 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RNF5 antibody: synthetic peptide directed towards the N terminal of human RNF5. Synthetic peptide located within the following region: AAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCL