Rabbit Polyclonal CD4 Antibody
| Applications | FC, ICC/IF, IHC, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
Rabbit Polyclonal Antibody against CD19 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD19 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 143-172 amino acids from the N-terminal region of human CD19. |
Goat Polyclonal Anti-CD45 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 1,260 aa to the C-terminus of human CD45 produced in E. coli. |
Goat Polyclonal Anti-CD19 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide within residues 510 aa to the C-terminus of human CD19 produced in E. coli. |
Rabbit Polyclonal Antibody against CD8A (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 59-88 amino acids from the N-terminal region of human CD8A. |
Rabbit anti-IL7R Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IL7R |
Goat Polyclonal Anti-CD4 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within 50 to 235 aa, corresponding to the external domain of human CD4 produced in E. coli. |
Rabbit Polyclonal Antibody against CD8A (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 150-180 amino acids from the C-terminal region of human CD8A. |
Rabbit Polyclonal Anti-TAP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TAP1 Antibody: synthetic peptide directed towards the middle region of human TAP1. Synthetic peptide located within the following region: LVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGL |
Germany
Japan
United Kingdom
China
