Antibodies

Jump to Filters
View as table Download
P Glycoprotein (ABCB1) Rabbit Polyclonal Antibody
AP20641PU-N

USD 465.00

3 Weeks

P Glycoprotein (ABCB1) rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PMP70 (ABCD3) Goat Polyclonal Antibody
TA305866

USD 520.00

5 Days

Goat Anti-ABCD3 Antibody

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat)
Conjugation Unconjugated
Immunogen Peptide with sequence C-PDGREDQKRKGISD, from the internal region of the protein sequence according to NP_002849.1.
ABCB10 Rabbit Polyclonal Antibody
TA332000

USD 539.00

5 Days

Rabbit Polyclonal Anti-Abcb10 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Abcb10 Antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: TRTGELINRLSSDTALLGHSVTENLSDGLRAVAQASVGVGMMFFVSPSLA