Antibodies

Jump to Filters
View as table Download
OR8H3 Rabbit Polyclonal Antibody
TA316423

USD 380.00

4 Weeks

Rabbit polyclonal anti-OR8H3 antibody

Applications IF
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR8H3.
OR8H3 Rabbit Polyclonal Antibody
TA332290

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR8H3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR8H3 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR8H3. Synthetic peptide located within the following region: LKPRKSYSLGRDQVAPVFYTIVIPMLNPLIYSLRNREVKNALIRVMQRRQ