Antibodies

Jump to Filters
View as table Download
CADM3 Rabbit Polyclonal Antibody
TA349731

USD 380.00

In Stock

Rabbit Polyclonal Anti-CADM3 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CADM3
CADM3 Rabbit Polyclonal Antibody
TA315688

USD 380.00

4 Weeks

Rabbit polyclonal anti-CADM3 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CADM3.
CADM3 Rabbit Polyclonal Antibody
TA338464

USD 539.00

5 Days

Rabbit Polyclonal Anti-CADM3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CADM3 antibody: synthetic peptide directed towards the middle region of human CADM3. Synthetic peptide located within the following region: KDTATLNCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSV