Rabbit polyclonal SPI1 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Pig) |
| Conjugation | Unconjugated |
| Immunogen | This SPI1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 217-246 amino acids from the C-terminal region of human SPI1. |
Goat Polyclonal Antibody against SPI1
| Applications | IHC, WB |
| Reactivities | Human (Expected from sequence similarity: Rat) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DLYQRQTHEYY, from the internal region of the protein sequence according to NP_001074016.1; NP_003111.2. |
Rabbit polyclonal SPI1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | he antiserum was produced against synthesized peptide derived from internal of human SPI1. |
Rabbit Polyclonal anti-SPI1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SPI1 antibody is: synthetic peptide directed towards the N-terminal region of Human SPI1. Synthetic peptide located within the following region: MEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPH |
Rabbit Polyclonal anti-SPI1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SPI1 antibody: synthetic peptide directed towards the middle region of human SPI1. Synthetic peptide located within the following region: HPSLGHQVSYLPRMCLQYPSLSPAQPSSDEEEGERQSPPLEVSDGEADGL |
Rabbit Polyclonal Anti-SPI1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SPI1 Antibody: synthetic peptide directed towards the middle region of human SPI1. Synthetic peptide located within the following region: QKGNRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGRGGLAER |
Germany
Japan
United Kingdom
China
