Antibodies

Jump to Filters
View as table Download
Cyclophilin E (PPIE) Rabbit Polyclonal Antibody
TA345947

USD 485.00

5 Days

Rabbit Polyclonal Anti-PPIE Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPIE antibody: synthetic peptide directed towards the middle region of human PPIE. Synthetic peptide located within the following region: KKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKP
Cyclophilin E (PPIE) Rabbit Polyclonal Antibody
TA345946

USD 485.00

5 Days

Rabbit Polyclonal Anti-PPIE Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPIE antibody: synthetic peptide directed towards the middle region of human PPIE. Synthetic peptide located within the following region: RIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSG