Rabbit polyclonal RBPJL Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RBPJL antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 8-36 amino acids from the N-terminal region of human RBPJL. |
Rabbit Polyclonal Anti-RBPJL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RBPJL antibody: synthetic peptide directed towards the middle region of human RBPJL. Synthetic peptide located within the following region: TIIGTESVEFSFSTSLACTLEPVTPVPLISTLELSGGGDVATLELHGENF |
Rabbit Polyclonal Anti-RBPJL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RBPJL Antibody: synthetic peptide directed towards the N terminal of human RBPJL. Synthetic peptide located within the following region: AHQAGETGPTVCGYMGLDSASGSATETQKLNFEQQPDSREFGCAKTLYIS |
Rabbit Polyclonal Anti-RBPJL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RBPJL antibody is: synthetic peptide directed towards the N-terminal region of Human RBPJL. Synthetic peptide located within the following region: DPAGAADPSVPPNPLTHLSLQDRSEMQLQSEADRRSLPGTWTRSSPEHTT |
Germany
Japan
United Kingdom
China
