Rabbit Polyclonal Anti-CRLF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CRLF1 antibody: synthetic peptide directed towards the middle region of human CRLF1. Synthetic peptide located within the following region: QLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVSNQTSCRLAGL |
Rabbit polyclonal antibody to Cytokine receptor-like factor 1 (cytokine receptor-like factor 1)
| Applications | WB |
| Reactivities | Human (Predicted: Mouse, Rat) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 130 and 415 of CRLF1 (Uniprot ID#O75462) |
CRLF1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China