Antibodies

View as table Download

Rabbit Polyclonal Anti-GH2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human GH2

Rabbit Polyclonal anti-GH2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GH2 antibody: synthetic peptide directed towards the middle region of human GH2. Synthetic peptide located within the following region: LEEGIQTLIGWKMAAPGLGRSSISPTASLTQNRTTMTHCSRTTGCSTASG

Rabbit Polyclonal Anti-GH2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GH2 antibody: synthetic peptide directed towards the middle region of human GH2. Synthetic peptide located within the following region: NQSYSKFDTKSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSC