Antibodies

Jump to Filters
View as table Download
ACVRL1 Rabbit Polyclonal Antibody
TA311718

USD 380.00

In Stock

Rabbit polyclonal anti-ACVL1 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ACVL1.
ACVRL1 Rabbit Polyclonal Antibody
TA334641

USD 539.00

5 Days

Rabbit Polyclonal Anti-ACVRL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACVRL1 antibody: synthetic peptide directed towards the N terminal of human ACVRL1. Synthetic peptide located within the following region: SPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNH