Rabbit Polyclonal Anti-USP2 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human USP2 |
Rabbit Polyclonal Anti-USP2 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human USP2 |
USP2 Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Bovine, Dog, Gorilla, Human, Monkey, Mouse, Rabbit, Rat, Gibbon, Hamster, Horse (Predicted: Pig) |
Conjugation | Unconjugated |
Immunogen | USP2 antibody was raised against synthetic 17 amino acid peptide from C-terminus of human USP2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Dog, Bovine, Hamster, Elephant, Panda, Horse, Rabbit, Opossum (100%); Pig (94%). |
Rabbit Polyclonal Anti-USP2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-USP2 antibody: synthetic peptide directed towards the middle region of human USP2. Synthetic peptide located within the following region: NEVNRVTLRPKSNPENLDHLPDDEKGRQMWRKYLEREDSRIGDLFVGQLK |
Rabbit Polyclonal Anti-USP2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-USP2 antibody: synthetic peptide directed towards the N terminal of human USP2. Synthetic peptide located within the following region: LLDYDRGRPLLRPDITGGGKRAESQTRGTERPLGSGLSGGSGFPYGVTNN |
USP2 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human USP2 |
USP2 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human USP2 |