Germany
Japan
United Kingdom
China
Rabbit Polyclonal SHP-2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human SHP-2 |
Antibodies
View as table Download
Rabbit Polyclonal SHP-2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human SHP-2 |
SHP2 (PTPN11) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide mapping at the C-terminal of Human SHP-2 |
Goat Polyclonal Antibody against SHP2 / PTPN11
| Applications | WB |
| Reactivities | Human, Mouse (Expected from sequence similarity: Rat, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-YENVGLMQQQKSFR, from the C Terminus of the protein sequence according to NP_002825.3. |
Goat Polyclonal Antibody against PTPN6 (Internal Region)
| Applications | WB |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KASRTSSKHKEE, from the internal region of the protein sequence according to NP_536858.1; NP_002822.2. |
Rabbit Polyclonal SHP2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | SHP2 antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human SHP2. |
Rabbit Polyclonal Anti-Ppp3cb Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Ppp3cb antibody is: synthetic peptide directed towards the middle region of Rat Ppp3cb. Synthetic peptide located within the following region: MCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLS |
Calcineurin A (PPP3CA) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A peptide conjugated to KLH |
Calcineurin A (PPP3CA) sheep polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A purified peptide conjugated to KLH |
Active filters
Reactivities
- Rat
Isotypes
- IgG
Clonalities
- Polyclonal
Families
- Phosphatase
Pathways
- Natural killer cell mediated cytotoxicity