Antibodies

Jump to Filters
View as table Download
TRPC4 Rabbit Polyclonal Antibody
TA338575

USD 539.00

5 Days

Rabbit Polyclonal Anti-TRPC4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRPC4 antibody: synthetic peptide directed towards the middle region of human TRPC4. Synthetic peptide located within the following region: CPFKSEKVVVEDTVPIIPKEKHAKEEDSSIDYDLNLPDTVTHEDYVTTRL
TRPC4 Goat Polyclonal Antibody
TA305678

USD 520.00

5 Days

Goat Anti-TRPC4 Antibody

Applications WB
Reactivities Rat (Expected from sequence similarity: Human, Mouse, Dog, Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-KHAKEEDSSIDYD, from the internal region (near C-Terminus) of the protein sequence according to NP_057263.1.