Antibodies

Jump to Filters
View as table Download
Angiotensin Converting Enzyme 1 (ACE) Rabbit Polyclonal Antibody
TA350853

USD 380.00

In Stock

Rabbit Polyclonal Anti-ACE Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ACE
CD13 (ANPEP) Rabbit Polyclonal Antibody
TA350805

USD 380.00

In Stock

Rabbit Polyclonal Anti-ANPEP Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ANPEP
Aminopeptidase A (ENPEP) Rabbit Polyclonal Antibody
TA590717

USD 482.00

In Stock

Rabbit Polyclonal Aminopeptidase A/APA Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
Aminopeptidase A (ENPEP) Goat Polyclonal Antibody
TA303036

USD 520.00

In Stock

Goat Polyclonal Antibody against ENPEP

Applications IHC, WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-EQYQKTSLAQEKEK, from the internal region of the protein sequence according to NP_001968.2.
Angiotensin Converting Enzyme 1 (ACE) Rabbit Polyclonal Antibody
TA323567

USD 380.00

In Stock

Anti-ACE1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 78-92 amino acids of Human Angiotensin-converting enzyme
CD13 (ANPEP) Rabbit Polyclonal Antibody
TA332824

USD 365.00

3 Weeks

Rabbit anti-ANPEP Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ANPEP
CD13 (ANPEP) Rabbit Polyclonal Antibody
TA343101

USD 539.00

5 Days

Rabbit Polyclonal Anti-ANPEP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ANPEP antibody: synthetic peptide directed towards the N terminal of human ANPEP. Synthetic peptide located within the following region: VGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLA
CD13 (ANPEP) Goat Polyclonal Antibody
TA329672

USD 520.00

5 Days

Goat Anti-CD13 / ANPEP (aa79-91) Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TLKPDSYRVTLRP, from the internal region (near N terminus) of the protein sequence according to NP_001141.2
CD13 (ANPEP) Goat Polyclonal Antibody
TA329673

USD 520.00

5 Days

Goat Anti-CD13 / ANPEP Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QLEQFKKDNEET, from the internal region (near C terminus) of the protein sequence according to NP_001141.2
Angiotensin Converting Enzyme 1 (ACE) Rabbit Polyclonal Antibody
TA347909

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-ACE1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ACE1 Antibody: A synthesized peptide derived from human ACE1