Antibodies

Jump to Filters
View as table Download
OR1A2 Rabbit Polyclonal Antibody
TA331997

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR1A2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR1A2 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR1A2. Synthetic peptide located within the following region: YGTTMGMYFRPLTSYSPKDAVITVMYVAVTPALNPFIYSLRNWDMKAALQ
OR1A2 Rabbit Polyclonal Antibody
TA360400

USD 539.00

5 Days

OR1A2 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human OR1A2