Antibodies

View as table Download

Rabbit anti-ARG1 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ARG1

Rabbit anti-ODC1 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ODC1

Rabbit anti-PRODH Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PRODH

eNOS (NOS3) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Goat Polyclonal Antibody against CKB / Brain Creatine Kinase

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-KPSDEHKTDLNPDN, from the internal region of the protein sequence according to NP_001814.2.

Goat Polyclonal Antibody against MAOB

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-HKARKLARLTKEE, from the internal region of the protein sequence according to NP_000889.3.

Goat Anti-ALDH1B1 Antibody

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Pig)
Conjugation Unconjugated
Immunogen Peptide with sequence C-DKEQFERVLGYIQ, from the interral region of the protein sequence according to NP_000683.3.

Rabbit Polyclonal eNOS (Thr494) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human eNOS around the phosphorylation site of Threonine 494.
Modifications Phospho-specific

Rabbit anti-NOS1 Polyclonal Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Recombinant Protein of human NOS1

Rabbit Polyclonal Anti-Aldh4a1 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Aldh4a1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: GSGLRWKHASSLKVANEPILAFTQGSPERDALQKALNDLKDQTEAIPCVV

Rabbit Polyclonal Anti-nNOS Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-nNOS Antibody: A synthesized peptide derived from human nNOS

Rabbit Polyclonal Anti-Phospho-eNOS(Ser615) Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Phospho-eNOS(Ser615) Antibody: A synthesized peptide derived from human eNOS around the phosphorylation site of Sersine 615
Modifications Phospho-specific

Rabbit Polyclonal Anti-Phospho-n-NOS (Ser852) Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Phospho-n-NOS (Ser852) Antibody: A synthesized peptide derived from human n-NOS around the phosphorylation site of Serine 852
Modifications Phospho-specific

Rabbit polyclonal eNOS (Ser615) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human eNOS around the phosphorylation site of serine 615 (F-N-SP-I-S).
Modifications Phospho-specific

Rabbit polyclonal Inos (Tyr151) antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Inos around the phosphorylation site of tyrosine 151 (Q-Y-YP-G-S).
Modifications Phospho-specific