Goat Anti-NR5A2 / LRH1 Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TDYDRSPFVTSPIS, from the internal region of the protein sequence according to NP_995582.1; NP_003813.1. |
Rabbit Polyclonal Anti-HNF1B Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNF1B antibody: synthetic peptide directed towards the N terminal of human HNF1B. Synthetic peptide located within the following region: LETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPIL |
Rabbit Polyclonal Anti-HNF1B Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNF1B antibody: synthetic peptide directed towards the N terminal of human HNF1B. Synthetic peptide located within the following region: LETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPIL |
Phospho-HNF4A-S304 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S304 of human HNF4A |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-Neuro D Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Neuro D Antibody: A synthesized peptide derived from human Neuro D |
Rabbit Polyclonal Anti-HNF4alpha /gamma Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNF4alpha /gamma Antibody: A synthesized peptide derived from human HNF4alpha /gamma |
Rabbit Polyclonal Anti-HNF-1β(TCF-2) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNF-1β(TCF-2) Antibody: Peptide sequence around aa.252~256(R-Q-K-N-P) derived from Human HNF-1b(TCF-2). |
Hex (HHEX) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminal of human HHEX (24-39aa) |
Germany
Japan
United Kingdom
China