Antibodies

Jump to Filters
View as table Download
Adenosine A2b Receptor (ADORA2B) Goat Polyclonal Antibody
TA305620

USD 520.00

5 Days

Goat Anti-Adenosine A2b Receptor Antibody

Applications FC, IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CQADVKSGNGQ, from the C Terminus of the protein sequence according to NP_000667.1.
Adenosine A2b Receptor (ADORA2B) Rabbit Polyclonal Antibody
TA349146

USD 570.00

5 Days

Rabbit Polyclonal Anti-ADORA2B Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ADORA2B antibody was raised against a 19 amino acid peptide near the carboxy terminus of human ADORA2B. The immunogen is located within the last 50 amino acids of ADORA2B.
Adenosine A2b Receptor (ADORA2B) Rabbit Polyclonal Antibody
TA342791

USD 539.00

5 Days

Rabbit Polyclonal Anti-ADORA2B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADORA2B antibody: synthetic peptide directed towards the C terminal of human ADORA2B. Synthetic peptide located within the following region: AKSLAMIVGIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHAN