Antibodies

Jump to Filters
View as table Download
RNF125 Rabbit Polyclonal Antibody
TA315551

USD 380.00

4 Weeks

Rabbit polyclonal anti-RNF125 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RNF125.
RNF125 Rabbit Polyclonal Antibody
TA329868

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-RNF125 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RNF125 antibody: synthetic peptide directed towards the middle region of human RNF125. Synthetic peptide located within the following region: ENPSSFSGSLIRHLQVSHTLFYDDFIDFNIIEEALIRRVLDRSLLEYVNH