Rabbit polyclonal antibody to Phosphodiesterase 4B (phosphodiesterase 4B, cAMP-specific (phosphodiesterase E4 dunce homolog, Drosophila))
| Applications | WB |
| Reactivities | Human (Predicted: Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 489 and 736 of PDE4B (Uniprot ID#Q07343) |
Rabbit Polyclonal Anti-PDE4B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PDE4B Antibody: synthetic peptide directed towards the middle region of human PDE4B. Synthetic peptide located within the following region: QDILDTLEDNRNWYQSMIPQSPSPPLDEQNRDCQGLMEKFQFELTLDEED |
Goat Polyclonal Antibody against Phosphodiesterase 4B
| Applications | WB |
| Reactivities | Mouse (Expected from sequence similarity: Human, Rat) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DIDIATEDKSPVDT, from the C Terminus of the protein sequence according to NP_002591.2; NP_001032418.1; NP_001032416.1; NP_001032417.1. |
Germany
Japan
United Kingdom
China
