Antibodies

View as table Download

Goat Anti-MTHFD1 Antibody

Applications IHC, PEP-ELISA, WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat)
Conjugation Unconjugated
Immunogen Peptide with sequence RGDLNDCFIPCTPK, from the internal region of the protein sequence according to NP_005947.2.

Rabbit Polyclonal Anti-MTHFD1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MTHFD1 antibody: synthetic peptide directed towards the N terminal of human MTHFD1. Synthetic peptide located within the following region: RTTTESEVMKYITSLNEDSTVHGFLVQLPLDSENSINTEEVINAIAPEKD

Rabbit Polyclonal Anti-MTHFD1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MTHFD1 antibody: synthetic peptide directed towards the middle region of human MTHFD1. Synthetic peptide located within the following region: CMAKTHLSLSHNPEQKGVPTGFILPIRDIRASVGAGFLYPLVGTMSTMPG