Antibodies

View as table Download

Rabbit Polyclonal Anti-CEL Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CEL

Rabbit Polyclonal Anti-CEL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CEL antibody: synthetic peptide directed towards the middle region of human CEL. Synthetic peptide located within the following region: VTPTGDSETAPVPPTGDSGAPPVPPTGDSEAAPVPPTDDSKEAQMPAVIR