Antibodies

Jump to Filters
View as table Download
IL21 Rabbit Polyclonal Antibody
TA306076

USD 570.00

2 Weeks

Rabbit Polyclonal IL-21 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen IL-21 antibody was raised against a synthetic peptide corresponding to 15 amino acids near the center of human IL-21 precursor .
IL21 Rabbit Polyclonal Antibody
TA317844

USD 610.00

5 Days

IL-21 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen IL21 antibody was raised against a synthetic peptide corresponding to 15 amino acids near the center of human IL-21 precursor .
IL21 Rabbit Polyclonal Antibody
TA343043

USD 539.00

5 Days

Rabbit Polyclonal Anti-IL21 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL21 antibody is: synthetic peptide directed towards the C-terminal region of Human IL21. Synthetic peptide located within the following region: ERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKS
IL21 Rabbit Polyclonal Antibody
TA312662

USD 380.00

4 Weeks

Rabbit polyclonal anti-IL21 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human IL21.