Rabbit Polyclonal Anti-GTF2B Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2B antibody: synthetic peptide directed towards the C terminal of human GTF2B. Synthetic peptide located within the following region: SVAAAAIYMASQASAEKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLFP |
Rabbit Polyclonal Anti-TF2H2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TF2H2 Antibody: A synthesized peptide derived from human TF2H2 |
Rabbit Polyclonal antibody to TFIID (TATA box binding protein)
| Reactivities | Human (Predicted: Mouse, Rat, Chicken, Chimpanzee, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 158 and 339 of TFIID (Uniprot ID#P20226) |
Germany
Japan
United Kingdom
China