Antibodies

Jump to Filters
View as table Download
FOXD4 Rabbit Polyclonal Antibody
TA350670

USD 380.00

In Stock

Rabbit Polyclonal Anti-FOXD4 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human FOXD4
FOXD4 Rabbit Polyclonal Antibody
TA313874

USD 380.00

4 Weeks

Rabbit polyclonal anti-FOXD4 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human FOXD4.
FOXD4 (Center) Rabbit Polyclonal Antibody
AP51705PU-N

USD 580.00

2 Weeks

FOXD4 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 189-218 amino acids from the Central region of Human FOXD4 / FKHL9
Foxd4 Rabbit Polyclonal Antibody
TA341764

USD 539.00

5 Days

Rabbit Polyclonal Anti-Foxd4 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Foxd4 antibody: synthetic peptide directed towards the N terminal of mouse Foxd4. Synthetic peptide located within the following region: MNSARAGHLRSTPPPSPLSSDQDEVEIDVLAEEEDGDQTEEEDDEEESHK
FOXD4 Rabbit Polyclonal Antibody
TA342519

USD 539.00

5 Days

Rabbit Polyclonal Anti-FOXD4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXD4 antibody: synthetic peptide directed towards the C terminal of human FOXD4. Synthetic peptide located within the following region: ASALLRYQAVAEGSGLTSLAAPLGGEGTSPVFLVSPTPSSLAESAGPS
FOXD4 Rabbit Polyclonal Antibody
TA342520

USD 539.00

5 Days

Rabbit Polyclonal Anti-FOXD4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXD4 antibody: synthetic peptide directed towards the middle region of human FOXD4. Synthetic peptide located within the following region: DPASQDMFDNGSFLRRRKRFQRHQPTPGAHLPHPFPLPAAHAALHNPRPG
FOXD4 Rabbit Polyclonal Antibody
TA355822

USD 539.00

5 Days

FOXD4 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the n terminal region of human FOXD4