Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-FKBP8 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This protein A purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human FKBP8 protein. |
Rabbit Polyclonal Anti-FKBP8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FKBP8 antibody: synthetic peptide directed towards the N terminal of human FKBP8. Synthetic peptide located within the following region: GPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLS |
Rabbit Polyclonal Anti-FKBP8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FKBP8 antibody: synthetic peptide directed towards the C terminal of human FKBP8. Synthetic peptide located within the following region: AIPILRAALKLEPSNKTIHAELSKLVKKHAAQRSTETALYRKMLGNPSRL |
Rabbit Polyclonal antibody to FKBP8 (FK506 binding protein 8, 38kDa)
| Reactivities | Predicted: Human, Rhesus Monkey |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 42 and 276 of FKBP8 |
Active filters
Target Symbol
- FKBP38
Clonalities
- Polyclonal
Conjugates
- Unconjugated